ProteoIQ - Web Spectral Viewer

MS/MS Fragmentation of: DKATSNICTAQALLANMAAMYAVYHGPAGLK : Carbamidomethyl[+57.021464] (C8)

Source File: ANP2_B_25
Query: 832.832.3
Match to gene: NP_195027.1, glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]

Observed mass of peptide: 1085.0185546875, (+3)
Observed intensity of peptide: 1.2140322E7
Sequest Xcorr: 4.019898414611816
ProteoIQ - Web Spectral Viewer
# b++ b Residue y y++ #
1 58.5213 116.0348 D 3251.602 1626.3049 31
2 122.5688 244.1297 K 3136.575 1568.7914 30
3 158.0873 315.1669 A 3008.4801 1504.744 29
4 208.6112 416.2145 T 2937.443 1469.2254 28
5 252.1272 503.2466 S 2836.3953 1418.7016 27
6 309.1487 617.2895 N 2749.3632 1375.1855 26
7 365.6907 730.3736 I 2635.3203 1318.1641 25
8 445.706 890.4042 C +57.0215 2522.2362 1261.622 24
9 496.2299 991.4519 T 2362.2056 1181.6067 23
10 531.7484 1062.489 A 2261.1579 1131.0829 22
11 595.7777 1190.5476 Q 2190.1208 1095.5643 21
12 631.2963 1261.5847 A 2062.0622 1031.535 20
13 687.8383 1374.6688 L 1991.0251 996.0165 19
14 744.3803 1487.7529 L 1877.941 939.4744 18
15 779.8989 1558.79 A 1764.857 882.9324 17
16 836.9204 1672.8329 N 1693.8198 847.4138 16
17 902.4406 1803.8734 M 1579.7769 790.3924 15
18 937.9592 1874.9105 A 1448.7364 724.8721 14
19 973.4777 1945.9476 A 1377.6993 689.3536 13
20 1038.998 2076.9881 M 1306.6622 653.835 12
21 1120.5296 2240.0515 Y 1175.6217 588.3148 11
22 1156.0482 2311.0886 A 1012.5584 506.7831 10
23 1205.5824 2410.157 V 941.5212 471.2645 9
24 1287.1141 2573.2203 Y 842.4528 421.7303 8
25 1355.6435 2710.2792 H 679.3895 340.1987 7
26 1384.1543 2767.3007 G 542.3306 271.6692 6
27 1432.6807 2864.3535 P 485.3091 243.1585 5
28 1468.1992 2935.3906 A 388.2563 194.6321 4
29 1496.71 2992.4121 G 317.2192 159.1135 3
30 1553.252 3105.4961 L 260.1977 130.6028 2
31 1617.2995 3233.5911 K 147.1137 74.0607 1

#	b++	b	Residue	y	y++	#
1	58.5213	116.0348	D	3251.602	1626.3049	31
2	122.5688	244.1297	K	3136.575	1568.7914	30
3	158.0873	315.1669	A	3008.4801	1504.744	29
4	208.6112	416.2145	T	2937.443	1469.2254	28
5	252.1272	503.2466	S	2836.3953	1418.7016	27
6	309.1487	617.2895	N	2749.3632	1375.1855	26
7	365.6907	730.3736	I	2635.3203	1318.1641	25
8	445.706	890.4042	C +57.0215	2522.2362	1261.622	24
9	496.2299	991.4519	T	2362.2056	1181.6067	23
10	531.7484	1062.489	A	2261.1579	1131.0829	22
11	595.7777	1190.5476	Q	2190.1208	1095.5643	21
12	631.2963	1261.5847	A	2062.0622	1031.535	20
13	687.8383	1374.6688	L	1991.0251	996.0165	19
14	744.3803	1487.7529	L	1877.941	939.4744	18
15	779.8989	1558.79	A	1764.857	882.9324	17
16	836.9204	1672.8329	N	1693.8198	847.4138	16
17	902.4406	1803.8734	M	1579.7769	790.3924	15
18	937.9592	1874.9105	A	1448.7364	724.8721	14
19	973.4777	1945.9476	A	1377.6993	689.3536	13
20	1038.998	2076.9881	M	1306.6622	653.835	12
21	1120.5296	2240.0515	Y	1175.6217	588.3148	11
22	1156.0482	2311.0886	A	1012.5584	506.7831	10
23	1205.5824	2410.157	V	941.5212	471.2645	9
24	1287.1141	2573.2203	Y	842.4528	421.7303	8
25	1355.6435	2710.2792	H	679.3895	340.1987	7
26	1384.1543	2767.3007	G	542.3306	271.6692	6
27	1432.6807	2864.3535	P	485.3091	243.1585	5
28	1468.1992	2935.3906	A	388.2563	194.6321	4
29	1496.71	2992.4121	G	317.2192	159.1135	3
30	1553.252	3105.4961	L	260.1977	130.6028	2
31	1617.2995	3233.5911	K	147.1137	74.0607	1