ProteoIQ - Web Spectral Viewer

MS/MS Fragmentation of: IPEGMAVEQAAPLLCAGVTVYSPLSHFGLK : Carbamidomethyl[+57.021464] (C15)

Source File: ANP3_B_15
Query: 815.815.3
Match to gene: NP_195149.1, cinnamyl alcohol dehydrogenase 5 [Arabidopsis thaliana]

Observed mass of peptide: 1052.8129882812, (+3)
Observed intensity of peptide: 4.0355032E7
Sequest Xcorr: 4.784913539886475
ProteoIQ - Web Spectral Viewer
# b++ b Residue y y++ #
1 57.5499 114.0919 I 3155.6278 1578.3178 30
2 106.0762 211.1447 P 3042.5437 1521.7758 29
3 170.5975 340.1873 E 2945.491 1473.2494 28
4 199.1083 397.2087 G 2816.4484 1408.7281 27
5 264.6285 528.2492 M 2759.4269 1380.2174 26
6 300.1471 599.2863 A 2628.3864 1314.6971 25
7 349.6813 698.3548 V 2557.3493 1279.1786 24
8 414.2026 827.3974 E 2458.2809 1229.6443 23
9 478.2319 955.4559 Q 2329.2383 1165.123 22
10 513.7504 1026.4931 A 2201.1797 1101.0938 21
11 549.269 1097.5302 A 2130.1426 1065.5752 20
12 597.7954 1194.583 P 2059.1054 1030.0566 19
13 654.3374 1307.667 L 1962.0527 981.5303 18
14 710.8795 1420.7511 L 1848.9686 924.9882 17
15 790.8948 1580.7817 C +57.0215 1735.8845 868.4462 16
16 826.4133 1651.8189 A 1575.8539 788.4309 15
17 854.9241 1708.8403 G 1504.8168 752.9123 14
18 904.4583 1807.9088 V 1447.7953 724.4016 13
19 954.9821 1908.9564 T 1348.7269 674.8674 12
20 1004.5163 2008.0249 V 1247.6792 624.3435 11
21 1086.048 2171.0882 Y 1148.6108 574.8093 10
22 1129.564 2258.1202 S 985.5474 493.2776 9
23 1178.0904 2355.173 P 898.5154 449.7616 8
24 1234.6324 2468.2571 L 801.4626 401.2352 7
25 1278.1485 2555.2891 S 688.3786 344.6932 6
26 1346.6779 2692.348 H 601.3465 301.1772 5
27 1420.2121 2839.4164 F 464.2876 232.6477 4
28 1448.7229 2896.4379 G 317.2192 159.1135 3
29 1505.2649 3009.522 L 260.1977 130.6028 2
30 1569.3124 3137.6169 K 147.1137 74.0607 1

#	b++	b	Residue	y	y++	#
1	57.5499	114.0919	I	3155.6278	1578.3178	30
2	106.0762	211.1447	P	3042.5437	1521.7758	29
3	170.5975	340.1873	E	2945.491	1473.2494	28
4	199.1083	397.2087	G	2816.4484	1408.7281	27
5	264.6285	528.2492	M	2759.4269	1380.2174	26
6	300.1471	599.2863	A	2628.3864	1314.6971	25
7	349.6813	698.3548	V	2557.3493	1279.1786	24
8	414.2026	827.3974	E	2458.2809	1229.6443	23
9	478.2319	955.4559	Q	2329.2383	1165.123	22
10	513.7504	1026.4931	A	2201.1797	1101.0938	21
11	549.269	1097.5302	A	2130.1426	1065.5752	20
12	597.7954	1194.583	P	2059.1054	1030.0566	19
13	654.3374	1307.667	L	1962.0527	981.5303	18
14	710.8795	1420.7511	L	1848.9686	924.9882	17
15	790.8948	1580.7817	C +57.0215	1735.8845	868.4462	16
16	826.4133	1651.8189	A	1575.8539	788.4309	15
17	854.9241	1708.8403	G	1504.8168	752.9123	14
18	904.4583	1807.9088	V	1447.7953	724.4016	13
19	954.9821	1908.9564	T	1348.7269	674.8674	12
20	1004.5163	2008.0249	V	1247.6792	624.3435	11
21	1086.048	2171.0882	Y	1148.6108	574.8093	10
22	1129.564	2258.1202	S	985.5474	493.2776	9
23	1178.0904	2355.173	P	898.5154	449.7616	8
24	1234.6324	2468.2571	L	801.4626	401.2352	7
25	1278.1485	2555.2891	S	688.3786	344.6932	6
26	1346.6779	2692.348	H	601.3465	301.1772	5
27	1420.2121	2839.4164	F	464.2876	232.6477	4
28	1448.7229	2896.4379	G	317.2192	159.1135	3
29	1505.2649	3009.522	L	260.1977	130.6028	2
30	1569.3124	3137.6169	K	147.1137	74.0607	1