ProteoIQ - Web Spectral Viewer

MS/MS Fragmentation of: GMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR

Source File: ANP4_B_25
Query: 598.598.3
Match to gene: NP_565913.1, ribulose bisphosphate carboxylase/oxygenase activase [Arabidopsis thaliana]

Observed mass of peptide: 1109.6630859375, (+3)
Observed intensity of peptide: 1.04635248E8
Sequest Xcorr: 4.603734493255615
ProteoIQ - Web Spectral Viewer
# b++ b Residue y y++ #
1 29.5186 58.0293 G 3324.5786 1662.7932 31
2 95.0388 189.0698 M 3267.5571 1634.2825 30
3 144.573 288.1382 V 3136.5166 1568.7622 29
4 202.0865 403.1652 D 3037.4482 1519.228 28
5 245.6025 490.1972 S 2922.4213 1461.7145 27
6 295.1367 589.2656 V 2835.3892 1418.1985 26
7 368.6709 736.334 F 2736.3208 1368.6643 25
8 432.7002 864.3926 Q 2589.2524 1295.1301 24
9 468.2188 935.4297 A 2461.1938 1231.1008 23
10 516.7452 1032.4825 P 2390.1567 1195.5823 22
11 582.2654 1163.523 M 2293.1039 1147.0559 21
12 610.7761 1220.5445 G 2162.0634 1081.5356 20
13 661.3 1321.5921 T 2105.042 1053.0249 19
14 689.8107 1378.6136 G 2003.9943 1002.5011 18
15 740.3346 1479.6613 T 1946.9728 973.9903 17
16 808.864 1616.7202 H 1845.9251 923.4665 16
17 877.3935 1753.7791 H 1708.8662 854.937 15
18 912.912 1824.8162 A 1571.8073 786.4076 14
19 962.4462 1923.8846 V 1500.7702 750.889 13
20 1018.9883 2036.9687 L 1401.7018 701.3548 12
21 1062.5043 2124.0007 S 1288.6177 644.8128 11
22 1106.0203 2211.0328 S 1201.5857 601.2968 10
23 1187.552 2374.0961 Y 1114.5537 557.7807 9
24 1252.0733 2503.1387 E 951.4903 476.2491 8
25 1333.6049 2666.202 Y 822.4477 411.7278 7
26 1383.1391 2765.2705 V 659.3844 330.1961 6
27 1426.6552 2852.3025 S 560.316 280.6619 5
28 1490.6844 2980.3611 Q 473.2839 237.1459 4
29 1519.1952 3037.3825 G 345.2254 173.1166 3
30 1575.7372 3150.4666 L 288.2039 144.6059 2
31 1653.7878 3306.5677 R 175.1198 88.0638 1

#	b++	b	Residue	y	y++	#
1	29.5186	58.0293	G	3324.5786	1662.7932	31
2	95.0388	189.0698	M	3267.5571	1634.2825	30
3	144.573	288.1382	V	3136.5166	1568.7622	29
4	202.0865	403.1652	D	3037.4482	1519.228	28
5	245.6025	490.1972	S	2922.4213	1461.7145	27
6	295.1367	589.2656	V	2835.3892	1418.1985	26
7	368.6709	736.334	F	2736.3208	1368.6643	25
8	432.7002	864.3926	Q	2589.2524	1295.1301	24
9	468.2188	935.4297	A	2461.1938	1231.1008	23
10	516.7452	1032.4825	P	2390.1567	1195.5823	22
11	582.2654	1163.523	M	2293.1039	1147.0559	21
12	610.7761	1220.5445	G	2162.0634	1081.5356	20
13	661.3	1321.5921	T	2105.042	1053.0249	19
14	689.8107	1378.6136	G	2003.9943	1002.5011	18
15	740.3346	1479.6613	T	1946.9728	973.9903	17
16	808.864	1616.7202	H	1845.9251	923.4665	16
17	877.3935	1753.7791	H	1708.8662	854.937	15
18	912.912	1824.8162	A	1571.8073	786.4076	14
19	962.4462	1923.8846	V	1500.7702	750.889	13
20	1018.9883	2036.9687	L	1401.7018	701.3548	12
21	1062.5043	2124.0007	S	1288.6177	644.8128	11
22	1106.0203	2211.0328	S	1201.5857	601.2968	10
23	1187.552	2374.0961	Y	1114.5537	557.7807	9
24	1252.0733	2503.1387	E	951.4903	476.2491	8
25	1333.6049	2666.202	Y	822.4477	411.7278	7
26	1383.1391	2765.2705	V	659.3844	330.1961	6
27	1426.6552	2852.3025	S	560.316	280.6619	5
28	1490.6844	2980.3611	Q	473.2839	237.1459	4
29	1519.1952	3037.3825	G	345.2254	173.1166	3
30	1575.7372	3150.4666	L	288.2039	144.6059	2
31	1653.7878	3306.5677	R	175.1198	88.0638	1